1. Recombinant Proteins
  2. Others
  3. Niemann Pick C1/NPC1 Protein, Human (HEK293, His)

Niemann Pick C1/NPC1 Protein, Human (HEK293, His)

Cat. No.: HY-P74695
Handling Instructions Technical Support

The Niemann Pick C1/NPC1 protein is an intracellular cholesterol transporter that cooperates with NPC2 to promote cholesterol efflux from the endosomal/lysosomal compartment. NPC2 transfers unesterified cholesterol to the N-terminal domain of NPC1, where the cholesterol is bound in a hydrophobic pocket. Niemann Pick C1/NPC1 Protein, Human (HEK293, His) is the recombinant human-derived Niemann Pick C1/NPC1 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Niemann Pick C1/NPC1 protein is an intracellular cholesterol transporter that cooperates with NPC2 to promote cholesterol efflux from the endosomal/lysosomal compartment. NPC2 transfers unesterified cholesterol to the N-terminal domain of NPC1, where the cholesterol is bound in a hydrophobic pocket. Niemann Pick C1/NPC1 Protein, Human (HEK293, His) is the recombinant human-derived Niemann Pick C1/NPC1 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

The Niemann Pick C1 (NPC1) Protein serves as an intracellular cholesterol transporter, working in tandem with NPC2 to facilitate the egress of cholesterol from the endosomal/lysosomal compartment. Unesterified cholesterol released from LDLs in the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. Cholesterol binds to NPC1 with its hydroxyl group buried in the binding pocket, and NPC1 exhibits a higher affinity for oxysterol compared to cholesterol. Beyond cholesterol transport, NPC1 may play a role in vesicular trafficking in glia, crucial for maintaining the structural and functional integrity of nerve terminals. Additionally, NPC1 inhibits cholesterol-mediated mTORC1 activation through its interaction with SLC38A9. In the context of microbial infection, NPC1 acts as an endosomal entry receptor for ebolavirus, highlighting its diverse roles in cellular processes and its significance in health and disease.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

O15118-1 (R372-F622)

Gene ID
Molecular Construction
N-term
6*His
NPC1 (R372-F622)
Accession # O15118-1
C-term
Synonyms
NPC intracellular cholesterol transporter 1; Niemann-Pick C1 protein; NPC1
AA Sequence

RVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIYQPYPSGADVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLTISFTAERSIEDELNRESDSDVF

Molecular Weight

Approximately 38-55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Niemann Pick C1/NPC1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Niemann Pick C1/NPC1 Protein, Human (HEK293, His)
Cat. No.:
HY-P74695
Quantity:
MCE Japan Authorized Agent: