1. Recombinant Proteins
  2. Others
  3. Nicotinamide N-Methyltransferase/NNMT Protein, Human (His)

Nicotinamide N-Methyltransferase/NNMT Protein, Human (His)

Cat. No.: HY-P79286
Handling Instructions Technical Support

The nicotinamide N-methyltransferase (NNMT) protein catalyzes the methylation of nicotinamide using S-adenosyl-L-methionine to form N1-methylnicotinamide. NNMT affects pluripotent embryonic stem cell development and acts as a metabolic regulator, affecting adipose tissue energy expenditure, gluconeogenesis, and cholesterol biosynthesis. Nicotinamide N-Methyltransferase/NNMT Protein, Human (His) is the recombinant human-derived Nicotinamide N-Methyltransferase/NNMT protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The nicotinamide N-methyltransferase (NNMT) protein catalyzes the methylation of nicotinamide using S-adenosyl-L-methionine to form N1-methylnicotinamide. NNMT affects pluripotent embryonic stem cell development and acts as a metabolic regulator, affecting adipose tissue energy expenditure, gluconeogenesis, and cholesterol biosynthesis. Nicotinamide N-Methyltransferase/NNMT Protein, Human (His) is the recombinant human-derived Nicotinamide N-Methyltransferase/NNMT protein, expressed by E. coli , with C-His labeled tag.

Background

Nicotinamide N-Methyltransferase (NNMT) is responsible for catalyzing the N-methylation of nicotinamide, utilizing the universal methyl donor S-adenosyl-L-methionine to produce N1-methylnicotinamide and S-adenosyl-L-homocysteine, representing a prominent pathway for nicotinamide/vitamin B3 clearance. This enzymatic activity plays a central role in cellular methylation potential regulation by consuming S-adenosyl-L-methionine, thus limiting its availability for other methyltransferases. NNMT actively orchestrates genome-wide epigenetic and transcriptional changes through the hypomethylation of repressive chromatin marks, such as H3K27me3, and contributes to the establishment of low levels of repressive histone marks in pluripotent embryonic stem cell pre-implantation state during development. Functionally, NNMT acts as a metabolic regulator impacting white adipose tissue energy expenditure, hepatic gluconeogenesis, and cholesterol biosynthesis. In white adipocytes, it regulates polyamine flux and controls NAD(+) levels through the salvage pathway. Additionally, NNMT, by producing N1-methylnicotinamide, influences protein acetylation in hepatocytes, repressing the ubiquitination and enhancing the stability of the SIRT1 deacetylase. Furthermore, NNMT exhibits versatility by N-methylating other pyridines structurally related to nicotinamide, suggesting a role in xenobiotic detoxification.

Biological Activity

1.Measured by its ability to methylate nicotinamide. The specific activity is >65 pmol/min/μg.
2.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.0488 μg/mL, corresponding to a specific activity is 2.049×104 units/mg.

  • Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.0488 μg/mL, corresponding to a specific activity is 2.049×104 units/mg.
Species

Human

Source

E. coli

Tag

C-His

Accession

P40261 (M1-L264)

Gene ID
Molecular Construction
N-term
NNMT (M1-L264)
Accession # P40261
His
C-term
Synonyms
Nicotinamide N-methyltransferase; NNMT
AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Molecular Weight

Approximately 25-30

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Nicotinamide N-Methyltransferase/NNMT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nicotinamide N-Methyltransferase/NNMT Protein, Human (His)
Cat. No.:
HY-P79286
Quantity:
MCE Japan Authorized Agent: