1. Recombinant Proteins
  2. Others
  3. NHP2 Protein, Human (His)

The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

NHP2 plays an essential role in cellular processes by participating in ribosome biogenesis and telomere maintenance. As a component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, NHP2 contributes to the catalysis of pseudouridylation in rRNA, a modification critical for stabilizing rRNA conformation. Additionally, NHP2 is implicated in the correct processing and intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. The H/ACA snoRNP complex, comprising NHP2 along with other subunits, including GAR1, NOP10, and DKC1, forms a stable core involved in recognizing specific RNA substrates. During assembly, NHP2 interacts with NAF1, and the complex binds box H/ACA snoRNAs or TERC, with GAR1 and NHP2 mediating specific interactions. NHP2 is also associated with NOLC1/NOPP140. Moreover, NHP2 contributes to the telomerase holoenzyme complex, collaborating with TERT, WRAP53/TCAB1, DKC1, NOP10, and GAR1, in concert with other components such as TEP1, SMG6/EST1A, and POT1. These interactions underline the multifaceted roles of NHP2 in fundamental cellular functions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NX24 (M1-L153)

Gene ID
Molecular Construction
N-term
6*His
NHP2 (M1-L153)
Accession # Q9NX24
C-term
Protein Length

Full Length

Synonyms
H/ACA ribonucleoprotein complex subunit 2; Nucleolar protein family A member 2; snoRNP protein NHP2; NHP2; NOLA2; NHP2P.
AA Sequence

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

Predicted Molecular Mass
19.3 kDa
Molecular Weight

Approximately 22 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NHP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NHP2 Protein, Human (His)
Cat. No.:
HY-P71160
Quantity:
MCE Japan Authorized Agent: