1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin I1/Neuroserpin
  6. Neuroserpin Protein, Mouse (HEK293, His)

Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.

Background

Neuroserpin, a serine protease inhibitor, plays a crucial role in inhibiting plasminogen activators and plasmin, with no inhibitory effect on thrombin. Beyond its role as a protease inhibitor, it is implicated in the formation or reorganization of synaptic connections, contributing to synaptic plasticity in the adult nervous system. Additionally, there is a suggested protective role for neuroserpin in safeguarding neurons from cell damage mediated by tissue-type plasminogen activator. These functions underscore the significance of neuroserpin in regulating proteolytic activities and maintaining neuronal integrity in the intricate network of synaptic processes.

Biological Activity

Measured in a cell proliferation assay using rat C6 cells. The ED50 for this effect is 0.894 μg/mL, corresponding to a specific activity is 1.118×10[3] units/mg.

  • Measured in a cell proliferation assay using rat C6 cells. The ED50 for this effect is 0.894 μg/mL, corresponding to a specific activity is 1.118×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

O35684 (T17-L410)

Gene ID
Molecular Construction
N-term
Neuroserpin (T17-L410)
Accession # O35684
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Neuroserpin; Peptidase inhibitor 12; Serpin I1; SERPINI1
AA Sequence

TGATFPDETITEWSVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKSCIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPETMNTSGHDFEEL

Molecular Weight

Approximately 45-58 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Neuroserpin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuroserpin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74703
Quantity:
MCE Japan Authorized Agent: