1. Recombinant Proteins
  2. Receptor Proteins
  3. RTN4RL1/NgR3 Protein, Human (HEK293, His)

The RTN4RL1/NgR3 protein is a cell surface receptor that functionally affects postnatal brain development and axonal regeneration in the adult central nervous system. It aids in axonal migration across the midline of the brain and formation of the corpus callosum. RTN4RL1/NgR3 Protein, Human (HEK293, His) is the recombinant human-derived RTN4RL1/NgR3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RTN4RL1/NgR3 protein is a cell surface receptor that functionally affects postnatal brain development and axonal regeneration in the adult central nervous system. It aids in axonal migration across the midline of the brain and formation of the corpus callosum. RTN4RL1/NgR3 Protein, Human (HEK293, His) is the recombinant human-derived RTN4RL1/NgR3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

RTN4RL1/NgR3, a cell surface receptor, assumes a functionally redundant role in postnatal brain development, exerting regulatory control over axon regeneration in the adult central nervous system. Its contributions encompass guiding axon migration across the brain midline and facilitating the formation of the corpus callosum. Additionally, RTN4RL1 serves a protective function against motoneuronal apoptosis, potentially mediated by MAG. Notably, it plays a crucial role in inhibiting neurite outgrowth and axon regeneration through its interaction with neuronal chondroitin sulfate proteoglycans. The receptor's binding affinity extends to heparin. As observed in its family counterparts, RTN4RL1 participates in shaping dendritic spines and synapse numbers during brain development. Its signaling capability triggers the activation of Rho, culminating in downstream actin cytoskeleton reorganization. RTN4RL1 engages in a complex with RTN4R and NGFR, dependent on the presence of chondroitin sulfate proteoglycans, while displaying no interaction with MAG, OMG, and RTN4.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q86UN2 (C25-A419)

Gene ID
Molecular Construction
N-term
NgR3 (C25-A419)
Accession # Q86UN2
6*His
C-term
Protein Length

Partial

Synonyms
Reticulon-4 Receptor-Like 1; Nogo Receptor-Like 2; Nogo-66 Receptor Homolog 2; Nogo-66 Receptor-Related Protein 3; NgR3; RTN4RL1; NGRH2; NGRL2
AA Sequence

CPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQA

Molecular Weight

Approximately 63.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

RTN4RL1/NgR3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RTN4RL1/NgR3 Protein, Human (HEK293, His)
Cat. No.:
HY-P71159
Quantity:
MCE Japan Authorized Agent: