1. Recombinant Proteins
  2. Others
  3. NBL1 Protein, Human (HEK293, His)

NBL1 Protein, Human (HEK293, His)

Cat. No.: HY-P74736
COA Handling Instructions

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag. The total length of NBL1 Protein, Human (HEK293, His) is 165 a.a., with molecular weight of ~25 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag. The total length of NBL1 Protein, Human (HEK293, His) is 165 a.a., with molecular weight of ~25 kDa.

Background

NBL1 protein emerges as a potential tumor suppressor gene in neuroblastoma, suggesting its pivotal role in impeding cells from progressing into the critical G1/S stage of the transformation process. Notably, NBL1 functions as a homodimer, highlighting its involvement in regulatory mechanisms that govern cellular transformation and underscoring its potential contributions to the maintenance of normal cellular growth control.

Biological Activity

Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4, corresponding to a specific activity is 2.833×103 U/mg.

  • Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4., corresponding to a specific activity is 2.833 ×103 U/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P41271 (A17-D181)

Gene ID

100532736  [NCBI]/4681  [NCBI]

Molecular Construction
N-term
NBL1 (A17-D181)
Accession # P41271
His
C-term
Synonyms
Neuroblastoma suppressor of tumorigenicity 1; Protein N03; NBL1; DAN; DAND1
AA Sequence

AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Molecular Weight

Approximately 25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NBL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NBL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P74736
Quantity:
MCE Japan Authorized Agent: