1. Recombinant Proteins
  2. Others
  3. MUSTN1 Protein, Human (His)

The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.

Background

MUSTN1 Protein emerges as a potential player in the dynamic processes underlying the development and regeneration of the musculoskeletal system. Its implication suggests a crucial role in orchestrating the intricate molecular events that govern the formation and renewal of musculoskeletal tissues. The specificity of MUSTN1's involvement highlights its potential as a key regulator in the complex network of signaling pathways that contribute to musculoskeletal development and regeneration. Unraveling the precise mechanisms through which MUSTN1 functions could provide valuable insights into its role in cellular differentiation, tissue formation, and the broader processes essential for the maintenance and repair of the musculoskeletal system. Exploring the functional significance of MUSTN1 in these contexts holds promise for advancing our understanding of musculoskeletal biology and may open avenues for therapeutic interventions in conditions related to musculoskeletal development and regeneration.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8IVN3 (M1-G82)

Gene ID
Molecular Construction
N-term
His
MUSTN1 (M1-G82)
Accession # Q8IVN3
C-term
Protein Length

Full Length

Synonyms
Musculoskeletal embryonic nuclear protein 1; MUSTN1
AA Sequence

MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MUSTN1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MUSTN1 Protein, Human (His)
Cat. No.:
HY-P77093
Quantity:
MCE Japan Authorized Agent: