1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Murinoglobulin-1/Mug1 Protein, Mouse (His)

Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

Murinoglobulin-1 (Mug1) operates as a proteinase inhibitor through a specific proteolytic activation mechanism in the bait region. This activation triggers a reaction at the cysteinyl-glutamyl internal thiol ester site, leading to a conformational change that effectively traps or covalently binds the proteinase to the inhibitor. In tetrameric forms of this proteinase inhibitor, steric hindrance alone provides robust inhibition. However, in monomeric configurations, an additional covalent linkage is essential between the activated glutamyl residue and a terminal amino group of a lysine or another nucleophilic group on the proteinase for inhibition to be fully effective. This intricate process highlights Mug1's ability to modulate proteinase activity through a combination of structural and chemical interactions.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P28665 (700T-910E)

Gene ID

17836  [NCBI]

Molecular Construction
N-term
6*His
Mug1 (700T-910E)
Accession # P28665
C-term
Protein Length

Partial

Synonyms
Mug1; Mug-1Murinoglobulin-1; MuG1
AA Sequence

TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCI, 1 mM EDTA, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Murinoglobulin-1/Mug1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Murinoglobulin-1/Mug1 Protein, Mouse (His)
Cat. No.:
HY-P71452
Quantity:
MCE Japan Authorized Agent: