1. Recombinant Proteins
  2. Others
  3. MUCL1 Protein, Human (HEK293, His)

The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The MUCL1 protein is suggested to potentially play a role as a diagnostic marker for metastatic breast cancer, indicating its potential utility in identifying and characterizing this particular stage of the disease. The implication is that MUCL1 could serve as a molecular indicator, aiding in the diagnosis and assessment of metastatic breast cancer, which may have implications for treatment planning and prognosis. The precise mechanisms and specificity of MUCL1 in the context of breast cancer diagnosis remain areas of interest, highlighting its potential significance as a biomarker in clinical settings.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q96DR8 (N21-P90)

Gene ID
Molecular Construction
N-term
MUCL1 (N21-P90)
Accession # Q96DR8
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Mucin-like protein 1; Protein BS106; Small breast epithelial mucin; SBEM
AA Sequence

NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP

Molecular Weight

Approximately 20-30 kDa due to glycosylation

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MUCL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MUCL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P77091
Quantity:
MCE Japan Authorized Agent: