1. Recombinant Proteins
  2. Others
  3. Mucin-2/MUC2 Protein, Human (P.pastoris, His)

Mucin-2/MUC2 Protein, Human (P.pastoris, His)

Cat. No.: HY-P702599
Handling Instructions Technical Support

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag. ,

Background

MUC2 is a mucin that coats the epithelia of the intestines and other mucus membrane-containing organs, providing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. As the major constituent of colon mucus, it forms large polymeric networks secreted by goblet cells, covering the intestinal surfaces. These networks create hydrogels that shield the underlying epithelium from pathogens and hazardous materials while enabling nutrient absorption and gas exchange. MUC2 also acts as a divalent copper chaperone, protecting intestinal cells from copper toxicity and facilitating nutritional copper uptake. It binds both Cu2+ and Cu(1+) at adjacent sites, with Cu2+ reduced to Cu(1+) by vitamin C or dietary antioxidants, allowing its release for cellular uptake. Additionally, MUC2 gels store antimicrobial molecules for innate immunity, support the microbiome, lubricate tissues, and aid in waste removal. By similarity, goblet cells produce two forms of MUC2: a 'thick' mucus in the proximal colon that encases microbiota to form fecal pellets, and a 'thin' mucus in the distal colon that adheres to and lubricates the 'thick' mucus as it moves through the descending colon.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

Q02817 (V36-L240)

Gene ID

4583

Protein Length

Partial

Synonyms
Intestinal mucin 2; Intestinal mucin-2; MLP; MUC 2; MUC-2; Muc2; MUC2_HUMAN; Mucin 2; Mucin 2 intestinal; Mucin 2 intestinal/tracheal; Mucin 2 oligomeric mucus/gel forming; Mucin 2 precursor ; Mucin 2 tracheal ; Mucin like protein; Mucin-2; Mucin2; SMUC
AA Sequence

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Predicted Molecular Mass
29.4 kDa
Molecular Weight

Approximately 32 kDa.

Purity

Greater than 90 % as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Mucin-2/MUC2 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mucin-2/MUC2 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P702599
Quantity:
MCE Japan Authorized Agent: