1. Recombinant Proteins
  2. Others
  3. MTSS1 Protein, Human (His)

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag.

Background

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 enables actin monomer binding activity, dentical protein binding activity and signaling receptor binding activity. MTSS1 is involved in cellular response to fluid shear stress, negative regulation of epithelial cell proliferation and urogenital system development. MTSS1 acts upstream of or within several processes, including actin filament polymerization, adherens junction maintenance and magnesium ion homeostasis. MTSS1 is located in actin Cytoskeleton[1].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

EAW92073 (M1-S250)

Gene ID
Molecular Construction
N-term
His-MBP
MTSS1 (M1-S250)
Accession # EAW92073
C-term
Protein Length

Partial

Synonyms
Protein MTSS 1; Metastasis suppressor YGL-1; MTSS1; KIAA0429; MIM
AA Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGS

Molecular Weight

Approximately 28 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MTSS1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MTSS1 Protein, Human (His)
Cat. No.:
HY-P75930
Quantity:
MCE Japan Authorized Agent: