1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Ligases (EC 6)
  4. MTHFS Protein, Human (His)

MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.

Background

The MTHFS protein is integral to tetrahydrofolate metabolism, playing a pivotal role in the regulation of carbon flow within the folate-dependent one-carbon metabolic network. This network is essential for supplying carbon needed in the biosynthesis of critical cellular components, including purines, thymidine, and amino acids. Notably, MTHFS catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) into 5,10-methenyltetrahydrofolate, a crucial step in the folate cycle. This enzymatic activity underscores its significance in directing one-carbon units for various cellular processes. The MTHFS protein's contribution to maintaining the balance and availability of carbon intermediates is fundamental to cellular metabolism and supports essential biosynthetic pathways (

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P49914-1 (M1-A203)

Gene ID
Molecular Construction
N-term
MTHFS (M1-A203)
Accession # P49914-1
6*His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHu5-formyltetrahydrofolate cyclo-ligase/MTHFS, His; 5-formyltetrahydrofolate cyclo-ligase; 5,10-methenyl-tetrahydrofolate synthetase; MTHFS; Methenyl-THF synthetase
AA Sequence

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MTHFS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MTHFS Protein, Human (His)
Cat. No.:
HY-P70362
Quantity:
MCE Japan Authorized Agent: