1. Recombinant Proteins
  2. Receptor Proteins
  3. MPZL1 Protein, Human (HEK293, His)

MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MPZL1, a cell surface receptor intricately involved in signal transduction processes, plays a pivotal role in recruiting PTPN11/SHP-2 to the cell membrane, establishing itself as a putative substrate for PTPN11/SHP-2. As a major receptor for concanavalin-A (ConA), MPZL1 contributes to cellular signaling induced by ConA, likely involving Src family tyrosine-protein kinases. The isoform 3 variant appears to exert a dominant negative effect, inhibiting the tyrosine phosphorylation of MPZL1 induced by ConA. Notably, isoform 1, distinct from isoform 2 and isoform 3, is implicated in the regulation of integrin-mediated cell motility. The receptor also engages in interactions with phosphorylated PTPN11/SHP-2, underscoring its multifaceted involvement in signal transduction cascades.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95297 (S36-V162)

Gene ID
Molecular Construction
N-term
MPZL1 (S36-V162)
Accession # O95297
6*His
C-term
Protein Length

Partial

Synonyms
rHuMyelin protein zero-like protein 1/MPZL1, His; Myelin protein zero-like 1; isoform CRA_b; cDNA FLJ78597; highly similar to Homo sapiens myelin protein zero-like 1 (MPZL1); transcript variant 1; mRNA ; cDNA; FLJ96614; Homo sapiens myelin protein zero-like 1 (MPZL1); Mrna
AA Sequence

SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV

Molecular Weight

20-28 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MPZL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MPZL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70220
Quantity:
MCE Japan Authorized Agent: