1. Recombinant Proteins
  2. Others
  3. MORC3 Protein, Human (His-SUMO)

MORC3 protein is a nuclear matrix protein that forms MORC3-NB through an ATP-dependent mechanism to restrict viruses through IFN response regulation, which is critical for innate immunity.It regulates IFNB1 activation and has secondary IFN inhibitory functions.MORC3 Protein, Human (His-SUMO) is the recombinant human-derived MORC3 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MORC3 protein is a nuclear matrix protein that forms MORC3-NB through an ATP-dependent mechanism to restrict viruses through IFN response regulation, which is critical for innate immunity.It regulates IFNB1 activation and has secondary IFN inhibitory functions.MORC3 Protein, Human (His-SUMO) is the recombinant human-derived MORC3 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

MORC3 Protein, a nuclear matrix protein, orchestrates the formation of MORC3-NBs (nuclear bodies) through an ATP-dependent mechanism, playing a crucial role in innate immunity by restricting various viruses through modulation of the IFN response. Its primary antiviral function involves the regulation of an IFN-responsive element that activates IFNB1, safeguarded by a secondary IFN-repressing function. Sumoylated MORC3-NBs interact with PML-NBs, recruiting TP53 and SP100, thereby regulating TP53 activity. Additionally, MORC3 demonstrates in vitro RNA binding capability. Serving as a histone methylation reader, MORC3 binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2), and trimethylated (H3K4me3) 'Lys-4' on histone H3, with a preference order of H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0. In the context of microbial infection, MORC3 may be essential for influenza A transcription during viral infection.

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q14149 (1M-290Y)

Gene ID
Molecular Construction
N-term
6*His-SUMO
MORC3 (1M-290Y)
Accession # Q14149
C-term
Protein Length

Partial

Synonyms
KIAA0136; Microrchidia 3; MORC family CW type zinc finger 3; MORC family CW type zinc finger protein 3; MORC family CW-type zinc finger protein 3; MORC3; MORC3_HUMAN; Nuclear matrix protein 2; Nuclear matrix protein NXP2; NXP2; ZCW5; ZCWCC3
AA Sequence

MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Predicted Molecular Mass
48.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MORC3 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MORC3 Protein, Human (His-SUMO)
Cat. No.:
HY-P71545
Quantity:
MCE Japan Authorized Agent: