1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-26
  5. MMP-26 Protein, Human

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

Background

The MMP-26 protein demonstrates a broad substrate specificity, as it may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin, and alpha-1 proteinase inhibitor. Its capacity to enzymatically cleave these diverse substrates indicates its potential involvement in the degradation and remodeling of various extracellular matrix components. Additionally, MMP-26 is capable of activating progelatinase B, suggesting a regulatory role in modulating the activity of other matrix metalloproteinases. The diverse substrate hydrolysis and activation capabilities of MMP-26 underscore its significance in the dynamic processes of tissue remodeling and homeostasis within the extracellular matrix.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate Mca-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2 and the specific activity is > 60 pmol/min/µg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NRE1 (T90-P261)

Gene ID
Molecular Construction
N-term
MMP-26 (T90-P261)
Accession # Q9NRE1
C-term
Synonyms
Matrix metalloproteinase-26; MMP-26; Endometase; Matrilysin-2
AA Sequence

TSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Molecular Weight

Approximately 19 kDa.

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 2 mM CaCl2, pH 7.8. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-26 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-26 Protein, Human
Cat. No.:
HY-P76498
Quantity:
MCE Japan Authorized Agent: