1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-2
  5. MMP-2 Protein, Mouse (HEK293, His)

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MMP-2 Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

Background

MMP-2 protein is a versatile ubiquitinous metalloproteinase with involvement in various functions, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Apart from its role in degrading extracellular matrix proteins, it also acts on nonmatrix proteins such as big endothelial 1 and beta-type CGRP, promoting vasoconstriction. Furthermore, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways and myocardial oxidative stress regulation by influencing GSK3beta activity. Additionally, MMP-2 is implicated in the formation of fibrovascular tissues and its C-terminal non-catalytic fragment, PEX, exhibits anti-angiogenic and anti-tumor properties while inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, MMP-2 serves as a ligand for integrin alpha-v/beta-3 on the surface of blood vessels.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 4166.09 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)

Species

Mouse

Source

HEK293

Tag

N-His

Accession

NP_032636.1 (M409-C662)

Gene ID
Molecular Construction
N-term
His
MMP-2 (M409-C662)
Accession # NP_032636.1
C-term
Protein Length

Partial

Synonyms
72 kDa Type IV Collagenase; Gelatinase A; MMP-2; TBE-1; CLG4A
AA Sequence

MGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Weight

Approximately 34.54 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73810
Quantity:
MCE Japan Authorized Agent: