1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-16
  5. MMP-16 Protein, Human (I152N, His)

The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.

Background

MMP-16 (Matrix Metalloproteinase-16) is an endopeptidase pivotal in the degradation of diverse extracellular matrix components, including collagen type III and fibronectin. It demonstrates the ability to activate progelatinase A, contributing to the regulation of matrix remodeling in blood vessels. The short isoform of MMP-16 is particularly notable for its cleavage of fibronectin and collagen type III, albeit at a reduced rate, with no discernible effect on collagen types I, II, IV, and V. However, in the presence of CSPG4, MMP-16 may play a role in the degradation and invasion of type I collagen by melanoma cells. This dual functionality underscores the complex and context-dependent nature of MMP-16's involvement in extracellular matrix dynamics, highlighting its potential implications in physiological and pathological processes, including those associated with vascular remodeling and cancer progression.

Biological Activity

Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is >250 pmol/min/µg.

Species

Human

Source

E. coli

Tag

C-10*His

Accession

P51512 (A32-G291, I152N)

Gene ID
Molecular Construction
N-term
MMP-16 (A32-G291, I152N)
Accession # P51512
10*His
C-term
Protein Length

Partial

Synonyms
Matrix metalloproteinase-16; MMP16; MMP-16; MMP-X2; Membrane-type matrix metalloproteinase 3; MT-MMP 3; MTMMP3; Membrane-type-3 matrix metalloproteinase; MT3-MMP; MT3MMP; C8orf57; MMPX2; Matrix Metalloproteinase 16/Membrane Type 3 MMP
AA Sequence

ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG

Molecular Weight

Approximately 29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, 0.4% SKL, 20% glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MMP-16 Protein, Human (I152N, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-16 Protein, Human (I152N, His)
Cat. No.:
HY-P79097
Quantity:
MCE Japan Authorized Agent: