MMP-14 Protein, Human (HEK293, His)

MMP-14 protein is an endopeptidase that degrades collagen and activates progelatinase A. MMP-14 Protein, Human (HEK293, His) is the recombinant human-derived MMP-14 protein, expressed by HEK293, with C-8*His labeled tag.

MMP-14 Protein serves as a critical endopeptidase, targeting various components of the extracellular matrix, notably collagen, and playing a pivotal role in pericellular collagenolysis during development, contributing to the modeling of both skeletal and extraskeletal connective tissues. Additionally, MMP-14 activates progelatinase A, acting as a key player in the intricate regulation of the extracellular matrix. Beyond its matrix-degrading functions, MMP-14 is implicated in actin cytoskeleton reorganization by cleaving PTK7, highlighting its involvement in cellular processes beyond matrix remodeling. Furthermore, MMP-14 acts as a positive regulator of cell growth and migration through the activation of MMP15 and plays a crucial role in the formation of fibrovascular tissues in conjunction with pro-MMP2. Notably, MMP-14 cleaves ADGRB1, releasing vasculostatin-40, which exerts anti-angiogenic effects by inhibiting angiogenesis. This multifaceted functionality underscores MMP-14's significance in orchestrating diverse cellular processes and its potential as a therapeutic target in various physiological contexts.

Human

HEK293

C-8*His

P50281 (Y112-A541)

4232

Extracellular Domain

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAA

38-48 kDa.

Greater than 95% as determined by Bis-Tris PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 25 mM Tris, 150 mM NaCl ,pH 7.5.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.