1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-12
  5. MMP-12 Protein, Mouse (HEK293, His)

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The MMP-12 protein emerges as a potential contributor to tissue injury and remodeling, demonstrating significant elastolytic activity. Its versatility is reflected in its ability to accommodate both large and small amino acids at the P1' site, displaying a preference for leucine. Furthermore, MMP-12 exhibits specificity in substrate preferences, favoring aromatic or hydrophobic residues at the P1 site, with a preference for small hydrophobic residues, particularly alanine, at the P3 site. These characteristics underscore the intricate role of MMP-12 in the modulation of extracellular matrix components, suggesting its involvement in processes related to tissue remodeling and homeostasis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet. (The proenzyme needs to be activated by APMA for an activated form.)

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P34960 (A29-C473)

Gene ID
Molecular Construction
N-term
MMP-12 (A29-C473)
Accession # P34960
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuMacrophage metalloelastase/MMP12, His; Macrophage metalloelastase; MME; Matrix metalloproteinase-12; MMP-12; Mmp12; Mme; Mmel
AA Sequence

APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC

Molecular Weight

Approximately 64.0 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 500 mM NaCl,0.01%Tween80, 1 mM EDTA, 50% Glycerol, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MMP-12 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-12 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70342
Quantity:
MCE Japan Authorized Agent: