1. Recombinant Proteins
  2. CD Antigens
  3. Monocyte CD Proteins
  4. CD301/CLEC10A
  5. MGL2/CD301b Protein, Mouse (HEK293, His)

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293 , with N-6*His labeled tag.

Background

Macrophage Gal/GalNAc lectin 2 (MGL2 or CD301) is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. Besides, murine MGL2 interacts strongly to adenocarcinoma cells, indicating the role in tumor immunity[3].

Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q8JZN1 (S72-P332)

Gene ID

216864  [NCBI]

Molecular Construction
N-term
6*His
MGL2 (S72-P332)
Accession # Q8JZN1
C-term
Protein Length

Cytoplasmic Domain

Synonyms
Mgl2; CD301b; Macrophage galactose N-acetyl-galactosamine-specific lectin 2; Macrophage Galactose-type C-lectin 2
AA Sequence

SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MGL2/CD301b Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGL2/CD301b Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70874
Quantity:
MCE Japan Authorized Agent: