1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. TAM Receptor
  5. Mer Proteins Mer Proteins
  6. Mer Protein, Human (HEK293, His)

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MER proto-oncogene tyrosine kinase (MERTK) is a member of the MER/AXL/TYRO3 receptor kinase family and a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type domains, and one tyrosine kinase domain. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK has transmembrane receptor protein tyrosine kinase activity and is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling.Mutations in MERTK have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP)[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA.When Recombinant Mer Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human GAS6. The ED50 for this effect is 3.154 μg/mL.

  • Measured by its binding ability in a functional ELISA.When Recombinant Mer Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human GAS6. The ED50 for this effect is 3.154 μg/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q1RMG3 (M1-A323)

Gene ID

10461

Molecular Construction
N-term
Mer (M1-A323)
Accession # Q1RMG3
6*His
C-term
Protein Length

Partial

Synonyms
Tyrosine-protein kinase Mer/Proto-oncogene c-Mer/Receptor tyrosine kinase MerTK/MERTK/MER
AA Sequence

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Molecular Weight

60-120 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Mer Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mer Protein, Human (HEK293, His)
Cat. No.:
HY-P70958
Quantity:
MCE Japan Authorized Agent: