1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. TAM Receptor
  5. Mer Proteins Mer Proteins
  6. Mer Protein, Human (HEK293, His)

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MER proto-oncogene tyrosine kinase (MERTK) is a member of the MER/AXL/TYRO3 receptor kinase family and a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type domains, and one tyrosine kinase domain. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK has transmembrane receptor protein tyrosine kinase activity and is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling.Mutations in MERTK have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP)[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA.When Recombinant Mer Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human GAS6. The ED50 for this effect is 3.154 μg/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q1RMG3 (M1-A323)

Gene ID

10461

Molecular Construction
N-term
Mer (M1-A323)
Accession # Q1RMG3
6*His
C-term
Synonyms
Tyrosine-protein kinase Mer/Proto-oncogene c-Mer/Receptor tyrosine kinase MerTK/MERTK/MER
AA Sequence

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Molecular Weight

60-120 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Mer Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mer Protein, Human (HEK293, His)
Cat. No.:
HY-P70958
Quantity:
MCE Japan Authorized Agent: