MECR Protein, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Mitochondrial trans-2-enoyl-CoA reductase (MECR) is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis (mtFAS). MECR catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II). Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but MECR accepts both ACP and CoA thioesters as substrates in vitro. MECR provides octanoyl chain for lipoic acid biosynthesis, regulating protein lipoylation and mitochondrial respiratory activity. Knockdown of MECR inhibits cell proliferation and colony formation, promotes apoptosis, and inhibits metastasis in HCC cell lines BEL-7404. In addition, MECR mutations cause childhood-onset dystonia and optic atrophy^{[1][2][3][4][5][6]}.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

AAH01419.1 (P54-M373)

51102  [NCBI]

Partial

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Approximately 39.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.