1. Recombinant Proteins
  2. Others
  3. MecA Protein, S. aureus (His-SUMO)

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

The MecA protein, characterized by its homodimeric structure, serves a pivotal role in cellular protein quality control. Its primary function involves the recognition and precise targeting of unfolded and aggregated proteins, directing them either to the ClpC protease or to other proteins participating in proteolysis. Through its homodimeric configuration, MecA demonstrates a remarkable ability to engage with a diverse array of substrates, orchestrating their efficient degradation within the cellular proteolytic network. This process is integral for maintaining cellular integrity by preventing the accumulation of misfolded or aggregated proteins that could otherwise compromise cellular functions. The MecA protein thus stands as a key player in cellular proteostasis, ensuring the timely removal of aberrant proteins to safeguard overall cellular health. (

Species

Staphylococcus aureus

Source

E. coli

Tag

N-His;N-SUMO

Accession

P60186 (M1-E239)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
MecA (1M-239E)
Accession # P60186
C-term
Protein Length

Full Length

Synonyms
mecA; MW0880Adapter protein MecA
AA Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Predicted Molecular Mass
44.3 kDa
Molecular Weight

Approximately 44 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of Tris-based buffer, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MecA Protein, S. aureus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MecA Protein, S. aureus (His-SUMO)
Cat. No.:
HY-P71476
Quantity:
MCE Japan Authorized Agent: