MCEMP1 Protein, Human (HEK293, Fc)

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes^[1][2]. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag.

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells, such as lung-resident mast cells and alveolar macrophages. MCEMP1 is an inducible genes in many inflammatory diseases, and plays a critical in allergic and inflammatory lung diseases^[1].
In function, MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 signals through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation^[1]. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes^[2].Human MCEMP1 shares about 40% aa sequence identity with mouse and rat. Rat MCEMP1 shares about 78% aa sequence identity with mouse.

Measured by the ability of the immobilized protein to support the adhesion of THP‑1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 0.2521 μg/mL, corresponding to a specific activity is 3.967×10^3 units/mg.

Human

HEK293

N-mFc

Q8IX19-1 (K107-Q187)

199675  [NCBI]

Extracellular Domain

KNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

Approximately 40-50 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.