1. Recombinant Proteins
  2. Complement System
  3. Mannose-binding Protein
  4. Mannose-binding Protein A
  5. MBL1 Protein, Mouse (HEK293, His)

MBL1, a calcium-dependent lectin, recognizes microbial moieties, activating the lectin complement pathway.It also binds apoptotic and necrotic cells, aiding uptake by macrophages.As a homotrimer, MBL1 forms higher oligomeric complexes in the endoplasmic reticulum.MBL1's interaction with MASP1 and MASP2 enhances its role in immune response modulation and cellular recognition.MBL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MBL1 protein, expressed by HEK293 , with N-His, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MBL1, a calcium-dependent lectin, recognizes microbial moieties, activating the lectin complement pathway.It also binds apoptotic and necrotic cells, aiding uptake by macrophages.As a homotrimer, MBL1 forms higher oligomeric complexes in the endoplasmic reticulum.MBL1's interaction with MASP1 and MASP2 enhances its role in immune response modulation and cellular recognition.MBL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MBL1 protein, expressed by HEK293 , with N-His, N-6*His labeled tag.

Background

MBL1, a calcium-dependent lectin, plays a crucial role in the innate immune response by recognizing mannose, fucose, and N-acetylglucosamine moieties on various microorganisms, thereby activating the lectin complement pathway. Beyond its microbial interactions, MBL1 also binds to late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their uptake by macrophages. Existing as a homotrimer, MBL1 further assembles into higher oligomeric complexes through the association of two, three, or more homotrimers, a process occurring in the endoplasmic reticulum. Additionally, MBL1 interacts with MASP1 and MASP2, further contributing to its involvement in immune response modulation and cellular recognition processes.

Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

P39039/NP_034905.1 (S21-A239)

Gene ID

17194  [NCBI]

Molecular Construction
N-term
6*His
MBL1 (S21-A239)
Accession # P39039/NP_034905.1
C-term
Protein Length

Partial

Synonyms
Mannose-binding protein A; MBP-A; RaRF p28B
AA Sequence

SQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA

Molecular Weight

Approximately 32 kDa.

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MBL1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MBL1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76488
Quantity:
MCE Japan Authorized Agent: