1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

Cat. No.: HY-P702369
Handling Instructions Technical Support

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

Background

Matrix protein 2 (M2) forms a proton-selective ion channel crucial for efficient viral genome release during virus entry. After attaching to the cell surface, the virion undergoes endocytosis, and acidification of the endosome activates M2 ion channel. Proton influx disrupts interactions among viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, freeing the viral genome. M2 also modulates the secretory pathway of viral proteins and elevates intravesicular pH, preventing premature fusion-active conformation of hemagglutinin. Influenza A strains' M2 is inhibited by amantadine and rimantadine, though rapid emergence of amantadine-resistant variants is common.

Species

Virus

Source

E. coli Cell-free

Tag

N-6*His

Accession

A4GCM0 (M1-E97)

Gene ID

/

Molecular Construction
N-term
6*His
Matrix 2 (M1-E97)
Accession # A4GCM0
C-term
Synonyms
Matrix protein 2; Proton channel protein M2
AA Sequence

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Molecular Weight

15.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Documentation

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)
Cat. No.:
HY-P702369
Quantity:
MCE Japan Authorized Agent: