1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Matrix Protein 1
  5. Matrix protein 1/M1 Protein, H1N1 (NP_040978, His)

Matrix protein 1/M1 Protein, H1N1 (NP_040978, His)

Cat. No.: HY-P74762
Handling Instructions Technical Support

Matrix protein 1/M1 Protein is pivotal in virus replication, spanning entry, uncoating, assembly, and budding. Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP aids nuclear export. M1 forms a shell on the inner virion membrane, binding the RNP. During entry, M1 dissociates from the RNP, allowing nuclear transport for transcription. M1 influences virion shape, determining infectivity, with filamentous virions crucial for cell-to-cell spread and spherical virions for aerosol-based transmission. Matrix protein 1/M1 Protein, H1N1 (NP_040978, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Matrix protein 1/M1 Protein is pivotal in virus replication, spanning entry, uncoating, assembly, and budding. Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP aids nuclear export. M1 forms a shell on the inner virion membrane, binding the RNP. During entry, M1 dissociates from the RNP, allowing nuclear transport for transcription. M1 influences virion shape, determining infectivity, with filamentous virions crucial for cell-to-cell spread and spherical virions for aerosol-based transmission. Matrix protein 1/M1 Protein, H1N1 (NP_040978, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E. coli , with N-His labeled tag.

Background

Matrix protein 1 (M1) is integral to various stages of virus replication, playing essential roles from virus entry and uncoating to the assembly and budding of the virus particle. M1's binding to ribonucleocapsids (RNPs) in the nucleus is believed to inhibit viral transcription, and its interaction with viral NEP promotes the nuclear export of the complex, targeting it to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA potentially bring M1 into lipid rafts, despite it being a non-raft-associated protein. Within the virion, M1 forms a continuous shell on the inner side of the lipid bilayer, binding the RNP. During virus entry, the M2 ion channel acidifies the internal virion core, leading to M1 dissociation from the RNP. M1-free RNPs are then transported to the nucleus, allowing viral transcription and replication. Moreover, M1 determines the virion's shape, influencing whether it is spherical or filamentous. Clinical isolates of influenza often feature a significant proportion of filamentous virions, crucial for infecting neighboring cells, while spherical virions are better suited for aerosol-based spread between host organisms[1][2].

Species

Virus

Source

E. coli

Tag

N-His

Accession

NP_040978 (S2-K252)

Gene ID

956527  [NCBI]

Molecular Construction
N-term
His
H1N1 M1 (S2-K252)
Accession # NP_040978
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Influenza A H1N1 (A/Puerto Rico/8/34/Mount Sinai) Matrix protein 1 / M1 Protein (His)
AA Sequence

SLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Molecular Weight

Approximately 29 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM tris, 0.5 mM DTT, 0.5 mM EDTA, 5% glycerol, 50 mM NaCl, pH 7.6.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Matrix protein 1/M1 Protein, H1N1 (NP_040978, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Matrix protein 1/M1 Protein, H1N1 (NP_040978, His)
Cat. No.:
HY-P74762
Quantity:
MCE Japan Authorized Agent: