MARCO Protein, Mouse (HEK293, His)

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

MARCO Protein is a pattern recognition receptor (PRR) that has the ability to bind both Gram-positive and Gram-negative bacteria. It also plays a role in binding unopsonized particles by alveolar macrophages. Additionally, MARCO Protein can bind to the secretoglobin SCGB3A2. It forms a homotrimer structure that is disulfide-linked, and these trimers can further assemble into larger oligomers, creating a large surface area capable of interacting with very large ligands.

Mouse

HEK293

N-8*His

Q60754 (Q70-S518)

17167  [NCBI]

Extracellular Domain

QVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

55-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.