1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. MARCH2 Protein, Human (Cell-Free, His, SUMO)

MARCH2 Protein, Human (Cell-Free, His, SUMO)

Cat. No.: HY-P702365
Handling Instructions Technical Support

The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

Background

MARCH2, an E3 ubiquitin-protein ligase, orchestrates diverse cellular processes by mediating the ubiquitination and subsequent endocytosis of various substrates. It is implicated in the ubiquitination and lysosomal degradation of transferrin receptor (TFRC) and CD86, suggesting a role in regulating their cellular levels. Collaborating with GOPC/CAL, MARCH2 participates in the ubiquitination and lysosomal degradation of CFTR. Additionally, it regulates the intracellular trafficking and secretion of alpha1-antitrypsin/SERPINA1 and haptoglobin/HP by ubiquitinating and promoting the degradation of the cargo receptor ERGIC3. MARCH2 negatively modulates antiviral and antibacterial immune responses by repressing NF-kB and type 1 interferon signaling pathways through K48-linked polyubiquitination of IKBKG/NEMO. Moreover, its involvement in endosomal trafficking is indicated by its interaction with STX6. In the context of microbial infection, MARCH2 positively influences the degradation of the Vesicular stomatitis virus (VSV) G protein via the lysosomal degradation pathway, and it represses HIV-1 viral production, potentially impeding the translocation of HIV-1 env to the cell surface and reducing viral cell-cell transmission.

Species

Human

Source

E. coli Cell-free

Tag

N-6*His;N-SUMO

Accession

Q9P0N8 (M1-V246)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
MARCH2 (M1-V246)
Accession # Q9P0N8
C-term
Protein Length

Full Length

Synonyms
E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING finger protein 172; RING-type E3 ubiquitin transferase MARCHF2
AA Sequence

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Molecular Weight

43 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MARCH2 Protein, Human (Cell-Free, His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MARCH2 Protein, Human (Cell-Free, His, SUMO)
Cat. No.:
HY-P702365
Quantity:
MCE Japan Authorized Agent: