1. Recombinant Proteins
  2. Others
  3. Marapsin/Pancreasin Protein, Human (HEK293, His)

Marapsin/Pancreasin Protein, Human (HEK293, His)

Cat. No.: HY-P77077
Handling Instructions Technical Support

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Marapsin/Pancreasin protein, is predominantly expressed in the pancreas. This specific tissue distribution suggests a specialized role for Marapsin/Pancreasin within pancreatic function. Given its association with the pancreas, this protein likely plays a role in processes related to pancreatic physiology, such as enzyme secretion, digestion, or maintenance of tissue homeostasis. Further exploration of Marapsin/Pancreasin's molecular functions and interactions within the pancreas could provide valuable insights into its contributions to pancreatic health and function, potentially uncovering its involvement in key aspects of digestive processes or regulatory mechanisms specific to this vital organ.

Biological Activity

Measured by its ability to cleave a colorimetric peptide substrate, Z-GR-SBzl, in the presence of DTNB that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 12844.08 pmol/min/μg,

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BQR3 (A23-K290)

Gene ID
Molecular Construction
N-term
Marapsin (A23-K290)
Accession # Q9BQR3
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Serine protease 27; Marapsin; Pancreasin; PRSS27; MPN
AA Sequence

ATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK

Molecular Weight

Approximately 35-45 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Marapsin/Pancreasin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Marapsin/Pancreasin Protein, Human (HEK293, His)
Cat. No.:
HY-P77077
Quantity:
MCE Japan Authorized Agent: