1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Protein Tyrosine Kinases
  4. MAP3K1 Protein, Mouse (His)

MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) is a critical component of a protein kinase signal transduction cascade, playing a key role in cellular signaling. It functions by activating the ERK and JNK kinase pathways through the phosphorylation of MAP2K1 and MAP2K4. Additionally, MAP3K1 may phosphorylate the MAPK8/JNK1 kinase, further contributing to the regulation of cellular responses. Moreover, MAP3K1 has the ability to activate CHUK and IKBKB, central protein kinases in the NF-kappa-B pathway, suggesting its involvement in the modulation of immune and inflammatory responses. The multifaceted actions of MAP3K1 highlight its importance in orchestrating complex signaling networks, making it a crucial regulator of various cellular processes. (

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P53349 (Q1216-W1493)

Gene ID
Molecular Construction
N-term
6*His
MAP3K1 (Q1216-W1493)
Accession # P53349
C-term
Protein Length

Partial

Synonyms
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; MAP/ERK kinase kinase 1; MAPK/ERK kinase kinase 1; MEK kinase 1; mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase; mitogen-activated protein kinase kinase kinase 1
AA Sequence

QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW

Predicted Molecular Mass
34.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAP3K1 Protein, Mouse (His)
Cat. No.:
HY-P700593
Quantity:
MCE Japan Authorized Agent: