1. Recombinant Proteins
  2. Others
  3. MAP1LC3B Protein, Human

MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free.

Background

MAP1LC3B, a ubiquitin-like modifier, plays a pivotal role in autophagosomal vacuole formation, contributing to cellular homeostasis. Engaging in mitophagy, it regulates mitochondrial quantity and quality, preventing excess reactive oxygen species production and ensuring energy efficiency. During cellular stress, it binds C-18 ceramides, anchoring autophagolysosomes to outer mitochondrial membranes, facilitating damaged mitochondria elimination. Distinct from LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily, to which MAP1LC3B belongs, is crucial for later-stage autophagosome maturation. MAP1LC3B further promotes primary ciliogenesis and orchestrates the remodeling of endoplasmic reticulum subdomains into autophagosomes via interactions with TEX264. In response to nutrient stress, it recruits cofactor JMY, enhancing actin nucleation and autophagosome biogenesis. This versatile protein interacts with a multitude of partners, including SQSTM1 for inclusion body degradation, ATG13, MAPK15, BNIP3, KEAP1, PCM1, and TBC1D5, highlighting its involvement in diverse cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9GZQ8 (M1-V125)

Gene ID
Molecular Construction
N-term
MAP1LC3B (M1-V125)
Accession # Q9GZQ8
C-term
Protein Length

Full Length

Synonyms
Microtubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 light cha
AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Molecular Weight

Approximately 16.15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 2 mM DTT, pH 8.0 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

MAP1LC3B Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAP1LC3B Protein, Human
Cat. No.:
HY-P70909
Quantity:
MCE Japan Authorized Agent: