1. Recombinant Proteins
  2. Others
  3. MAP1LC3A Protein, Human (His)

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

Background

MAP1LC3A, a ubiquitin-like modifier, plays a crucial role in autophagosomal vacuole formation, contributing to cellular homeostasis. While participating in the elongation of the phagophore membrane, MAP1LC3A, belonging to the GABARAP/GATE-16 subfamily, assumes a vital role in the later stages of autophagosome maturation. It engages in the remodeling of endoplasmic reticulum subdomains into autophagosomes in response to nutrient stress, facilitating their subsequent fusion with lysosomes for endoplasmic reticulum turnover. With three different light chains (LC1, LC2, and LC3), it can associate with MAP1A and MAP1B proteins. MAP1LC3A exhibits a diverse interactome, engaging with proteins like TP53INP1, TP53INP2, SQSTM1 for inclusion body degradation, ATG13, ULK1, TBC1D5, UBQLN1, UBQLN2, UBQLN4, TRIM5, MEFV, and others. These interactions underscore the multifaceted role of MAP1LC3A in various cellular processes, including autophagy, protein aggregate degradation, and the regulation of reticulophagy.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9H492-1 (M1-F121)

Gene ID
Molecular Construction
N-term
MAP1LC3A (M1-F121)
Accession # Q9H492-1
6*His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Microtubule-Associated Proteins 1A/1B Light Chain 3A; Autophagy-Related Protein LC3 A; Autophagy-Related Ubiquitin-Like Modifier LC3 A; MAP1 Light Chain 3-Like Protein 1; MAP1A/MAP1B Light Chain 3 A; MAP1A/MAP1B LC3 A; Microtubule-Associated Protein 1 Light Cha
AA Sequence

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MAP1LC3A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAP1LC3A Protein, Human (His)
Cat. No.:
HY-P70916
Quantity:
MCE Japan Authorized Agent: