1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD68
  5. CD68 Protein, Human (HEK293, Fc)

CD68 protein is essential for phagocytic activities in tissue macrophages, including lysosomal metabolism and interactions with cells and pathogens. It binds to lectins or selectins, aiding targeted migration of specific macrophage subsets. CD68's rapid recirculation from endosomes and lysosomes to the plasma membrane allows macrophages to crawl or interact with selectin-bearing substrates and other cells. CD68 Protein, Human (HEK293, Fc) is the recombinant human-derived CD68 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD68 protein is essential for phagocytic activities in tissue macrophages, including lysosomal metabolism and interactions with cells and pathogens. It binds to lectins or selectins, aiding targeted migration of specific macrophage subsets. CD68's rapid recirculation from endosomes and lysosomes to the plasma membrane allows macrophages to crawl or interact with selectin-bearing substrates and other cells. CD68 Protein, Human (HEK293, Fc) is the recombinant human-derived CD68 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD68 protein is thought to play a crucial role in various phagocytic activities carried out by tissue macrophages, encompassing intracellular lysosomal metabolism as well as extracellular interactions with cells and pathogens. It has the ability to bind to tissue- and organ-specific lectins or selectins, facilitating the targeted migration of specific macrophage subsets to particular sites. The rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane enables macrophages to crawl over selectin-bearing substrates or interact with other cells.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P34810 (N22-I320)

Gene ID

968  [NCBI]

Molecular Construction
N-term
CD68 (N22-I320)
Accession # P34810
hFc
C-term
Synonyms
rHuMacrosialin/CD68, Fc ; CD68 antigenmacrophage antigen CD68; CD68 molecule; CD68; gp110; Macrosialin; SCARD1; SRD1; SR-D1
AA Sequence

NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSI

Molecular Weight

70-100 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD68 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70028
Quantity:
MCE Japan Authorized Agent: