TNF-beta/TNFSF1 Protein, Human (HEK293, His)

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-6*His labeled tag.

TNF-beta Protein, in its homotrimeric configuration, exhibits binding capabilities to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, as demonstrated by various studies. Additionally, in its heterotrimeric association with LTB, it forms interactions with TNFRSF3/LTBR, underscoring its diverse receptor engagement. This cytokine, primarily produced by lymphocytes, showcases cytotoxic effects against a broad array of tumor cells both in vitro and in vivo. Structurally, TNF-beta exists as both homotrimers and heterotrimers, the latter comprising either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Furthermore, TNF-beta engages in interactions with TNFRSF14, emphasizing its pivotal role in mediating intricate immunological responses.

Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/mL can bind human TNFRSF1B, the EC₅₀ is ≤4 ng/mL.

Human

HEK293

N-6*His

P01374 (L35-L205)

4049  [NCBI]

Full Length of Mature Protein

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

20.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.