1. Recombinant Proteins
  2. Others
  3. LY6G6D Protein, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

LY6G6D belongs to the leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. LY6G, a small protein attached to cell surfaces via glycosylphosphatidylinositol (GPI) anchor, is used as a marker for granulocyte and myeloid suppressor cell subpopulations in mice. LY6G6D participates in the JAK-STAT5 and RAS-MEK-ERK signaling pathways. LY6G6D is a selectively expressed colorectal cancer antigen that targets therapeutic T-cell responses via T-cell adaptors[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody , the EC50 is 2.816-9.81 ng/mL.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

O95868 (N20-S104)

Gene ID
Molecular Construction
N-term
6*His
LY6G6D (N20-S104)
Accession # O95868
C-term
Protein Length

Full Length of Mature Protein

Synonyms
LY66D_HUMAN; Ly6g6d; Lymphocyte antigen 6 complex locus protein G6d; Megakaryocyte-enhanced gene transcript 1 protein; Protein Ly6-D
AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LY6G6D Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LY6G6D Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71751
Quantity:
MCE Japan Authorized Agent: