1. Recombinant Proteins
  2. Others
  3. LSP1 Protein, Human (HEK293, His)

The LSP1 protein may play an important role in mediating neutrophil activation and chemotaxis, suggesting its involvement in immune responses. LSP1 is known to bind actin and may influence cytoskeletal dynamics critical for cell migration. LSP1 Protein, Human (HEK293, His) is the recombinant human-derived LSP1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LSP1 protein may play an important role in mediating neutrophil activation and chemotaxis, suggesting its involvement in immune responses. LSP1 is known to bind actin and may influence cytoskeletal dynamics critical for cell migration. LSP1 Protein, Human (HEK293, His) is the recombinant human-derived LSP1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The LSP1 protein is implicated in potentially playing a significant role in mediating neutrophil activation and chemotaxis, underscoring its involvement in the complex processes associated with the immune response. Functionally, LSP1 is known to bind actin, suggesting its participation in the cytoskeletal dynamics that are integral to cellular migration and chemotactic responses. The precise mechanisms by which LSP1 modulates neutrophil activation, chemotaxis, and its interactions with actin remain areas of interest, warranting further investigation to unravel its specific functions and molecular contributions in the intricate orchestration of immune cell responses.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P33241-1 (M1-P339)

Gene ID
Molecular Construction
N-term
LSP1 (M1-P339)
Accession # P33241
His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Lymphocyte-specific protein 1; 52 kDa phosphoprotein; pp52; WP34
AA Sequence

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

Molecular Weight

Approximately 60 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LSP1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSP1 Protein, Human (HEK293, His)
Cat. No.:
HY-P75916
Quantity:
MCE Japan Authorized Agent: