1. Recombinant Proteins
  2. Others
  3. LSM1 Protein, Human (His)

LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.

Background

LSM1 (Like-Sm Protein 1) takes center stage in the intricate process of histone mRNA degradation, a unique task among eukaryotic mRNAs due to their lack of polyadenylation. This essential protein is likely a crucial component of an LSm subunit-containing complex involved in the broader mechanism of mRNA degradation, contributing to the maintenance of cellular homeostasis. In particular, LSM1 forms a significant interaction with SLBP, emphasizing its role during the S phase when histone mRNA undergoes rapid degradation. The LSm subunits, when assembled, create a heteromer with a distinctive donut shape, further highlighting the structural complexity associated with their functional involvement in mRNA degradation pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O15116 (M1-Y133)

Gene ID
Molecular Construction
N-term
LSM1 (M1-Y133)
Accession # O15116
6*His
C-term
Protein Length

Full Length

Synonyms
rHuU6 snRNA-associated Sm-like protein LSm1, His; U6 snRNA-Associated Sm-Like Protein LSm1; Cancer-Associated Sm-Like; Small Nuclear Ribonuclear CaSm; LSM1; CASM
AA Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Molecular Weight

Approximately 19.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LSM1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSM1 Protein, Human (His)
Cat. No.:
HY-P70198
Quantity:
MCE Japan Authorized Agent: