1. Recombinant Proteins
  2. Others
  3. LRRC3B Protein, Human (HEK293, His)

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[1][2][3]. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Leucine-rich repeat-containing protein 3B (LRRC3B) is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers[1]. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[2]. Besides, It's reported that LRRC3B is up-regulated in the virus infected group compared with the control, indicating LRRC3B is involved in immune-related processes that trigger the innate immune response through activation of the IFN signaling pathway[3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96PB8 (C34-Y204)

Gene ID
Molecular Construction
N-term
LRRC3B (C34-Y204)
Accession # Q96PB8
6*His
C-term
Protein Length

Partial

Synonyms
Leucine-Rich Repeat-Containing Protein 3B; Leucine-Rich Repeat Protein LRP15; LRRC3B; LRP15
AA Sequence

CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDY

Predicted Molecular Mass
20 kDa
Molecular Weight

Approximately 20-29 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LRRC3B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRRC3B Protein, Human (HEK293, His)
Cat. No.:
HY-P70894
Quantity:
MCE Japan Authorized Agent: