1. Recombinant Proteins
  2. Others
  3. LRRC25 Protein, Human (HEK293, His)

The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

LRRC25 emerges as a crucial regulator in dampening RLR-mediated type I interferon signaling pathways, exerting its inhibitory influence by orchestrating the autophagic degradation of RIGI. The protein, through its specific interaction with ISG15-associated RIGI, facilitates the binding of RIGI to the autophagic cargo receptor p62/SQSTM1, leading to the selective autophagic degradation of RIGI. In addition to its role in immune modulation, LRRC25 plays a pivotal part in restraining the NF-kappa-B signaling pathway and mitigating inflammatory responses by fostering the degradation of p65/RELA. Notably, LRRC25 engages in direct interactions with RIGI, SQSTM1, and p65/RELA, underscoring its multifaceted involvement in orchestrating protein degradation processes and fine-tuning crucial cellular signaling cascades.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8N386 (L21-T165)

Gene ID
Molecular Construction
N-term
LRRC25 (L21-T165)
Accession # Q8N386
6*His
C-term
Synonyms
Leucine-rich repeat-containing protein 25; Monocyte and plasmacytoid-activated protein; MAPA; FLJ38116; UNQ6169/PRO20174
AA Sequence

LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASAT

Molecular Weight

25-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LRRC25 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRRC25 Protein, Human (HEK293, His)
Cat. No.:
HY-P70876
Quantity:
MCE Japan Authorized Agent: