LRG1 Protein, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

LRG1 is a member of the leucine-rich repeat sequence (LRR) family of proteins involved in protein-protein interactions, signal transduction, and cell adhesion and development. LRG1 is involved in promoting neovascularization (new blood vessel growth) by causing the switching of transforming growth factor β (TGF-β) signaling in endothelial cells. LRG1 binds to the co-receptor endorphins and promotes signaling through the ALK1-Smad1/5/8 pathway. LRG1 is involved in ovarian cancer progression by activating the FAK/AKT signaling pathway^[1][2][3].

Immobilized Mouse LRG1 Protein at 2 μg/mL (100 μL/well) can bind LRG1 antibody .The ED₅₀ for this effect is 89.21 ng/mL.

Mouse

HEK293

C-8*His

Q91XL1 (L33-L342)

76905  [NCBI]

Full Length of Mature Protein

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.