1. Recombinant Proteins
  2. Others
  3. LMCD1 Protein, Human (His)

The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

LMCD1, a transcriptional cofactor, serves as a regulatory brake on GATA6 function, exerting control by impeding GATA6's DNA-binding capacity and thereby suppressing its transcriptional activation of downstream target genes. Specifically, LMCD1 intervenes to repress GATA6-mediated transactivation of tissue-specific promoters in lung and cardiac tissues, displaying a crucial role in regulating these developmental processes. Additionally, LMCD1 acts as a modulator of DNA-binding by inhibiting GATA4 and GATA1 at the cTNC promoter. The intricate interplay between LMCD1 and GATA transcription factors underscores its significance in finely tuning gene expression, particularly in the context of cardiac hypertrophy, where LMCD1's activation of the calcineurin/nuclear factor of activated T-cells signaling pathway is implicated. LMCD1's molecular interactions extend to GATA1, GATA4, and beta-dystroglycan, highlighting its multifaceted involvement in transcriptional regulation and cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q9NZU5-1 (M1-S365)

Gene ID
Molecular Construction
N-term
6*His
LMCD1 (M1-S365)
Accession # Q9NZU5-1
6*His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
LIM and cysteine-rich domains protein 1; LMCD1; Dyxin
AA Sequence

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Predicted Molecular Mass
44 kDa
Molecular Weight

Approximately 45 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LMCD1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LMCD1 Protein, Human (His)
Cat. No.:
HY-P70926
Quantity:
MCE Japan Authorized Agent: