1. Recombinant Proteins
  2. Others
  3. LMAN2L Protein, Human (295a.a, HEK293, His)

The LMAN2L protein plays a critical role in cellular processes and may regulate the export of a specific subset of glycoproteins from the endoplasmic reticulum (ER). Its involvement in glycoprotein export suggests a regulatory function within the endoplasmic reticulum. LMAN2L Protein, Human (295a.a, HEK293, His) is the recombinant human-derived LMAN2L protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LMAN2L protein plays a critical role in cellular processes and may regulate the export of a specific subset of glycoproteins from the endoplasmic reticulum (ER). Its involvement in glycoprotein export suggests a regulatory function within the endoplasmic reticulum. LMAN2L Protein, Human (295a.a, HEK293, His) is the recombinant human-derived LMAN2L protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The LMAN2L protein appears to play a crucial role in cellular processes, potentially participating in the regulation of export from the endoplasmic reticulum (ER) for a specific subset of glycoproteins. Its involvement in the intricate process of glycoprotein export suggests a regulatory function within the ER. Furthermore, LMAN2L may act as a regulator of ERGIC-53, implicating its role in the control of protein trafficking between the ER and the ER-Golgi intermediate compartment (ERGIC). These dual functionalities underscore the significance of LMAN2L in cellular mechanisms, particularly in the orchestration of glycoprotein export and the regulation of ERGIC-53, highlighting its potential impact on intracellular protein transport and cellular homeostasis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9H0V9-1 (G45-A313)

Gene ID
Molecular Construction
N-term
LMAN2L (G45-A313)
Accession # Q9H0V9-1
6*His
C-term
Protein Length

Lumenal Domain

Synonyms
VIP36-like protein; Lectin mannose-binding 2-like; LMAN2-like protein; VIPL
AA Sequence

SARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLA

Predicted Molecular Mass
34.4 kDa
Molecular Weight

Approximately 30-45 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LMAN2L Protein, Human (295a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LMAN2L Protein, Human (295a.a, HEK293, His)
Cat. No.:
HY-P70914
Quantity:
MCE Japan Authorized Agent: