1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85j/LIR-1 CD85j/LIR-1
  5. LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc)

LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes. LILRB1 recognises a wide range of classical HLA-class I allelic variants, as well as the non-classical molecules HLA-F and -G by binding to the conserved a3 domain. LILRB1 also recognises the human CMV-encoded MHC class I homologue UL18. LILRB1 is encoded within the leukocyte receptor complex on 19q13.4. LILRB1 can function as a negative regulator of BiTE molecule-induced tumor cell killing. LILRB1 acts as a novel checkpoint inhibitory molecule capable of restricting BiTE molecule-mediated CD8+ T cell effector function. LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes. LILRB1 recognises a wide range of classical HLA-class I allelic variants, as well as the non-classical molecules HLA-F and -G by binding to the conserved a3 domain. LILRB1 also recognises the human CMV-encoded MHC class I homologue UL18. LILRB1 is encoded within the leukocyte receptor complex on 19q13.4. LILRB1 can function as a negative regulator of BiTE molecule-induced tumor cell killing. LILRB1 acts as a novel checkpoint inhibitory molecule capable of restricting BiTE molecule-mediated CD8+ T cell effector function[1][2][3][4]. LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

LILRB1 binds MHC class I and also contain immunoreceptor tyrosine-based inhibitory motifs involved in the intracellular transduction of inhibitory signaling, which establishes them as strong candidates for MHC class I-mediated suppression of phagocytosis[1].
LILRB1 and PD1 shows nonoverlapping expression patterns across CD8+ TEM and TEMRA subsets, and blocking both pathways synergistically enhanced CD8+ T cell function. LILRB1 is highly expressed by the CD8+ TEMRA subset, which is the most potent population for BiTE molecule–induced toxicity. LILRB1-expressing CD8+ T cells infiltrate solid tumors. LILRB1 blockade increases CD8+ T cell cytolytic activity in vitro[3].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

D9IDM8 (G24-H458)

Gene ID

10859

Molecular Construction
N-term
LILRB1 (G24-H458)
Accession # D9IDM8
hFc
C-term
Protein Length

Partial

Synonyms
rHuLIR-1/LILRB1, Fc; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1; LIR-1; Leukocyte Immunoglobulin-Like Receptor 1; CD85 Antigen-Like Family Member J; Immunoglobulin-Like Transcript 2; ILT-2; Monocyte/Macrophage Immunoglobulin-Like Receptor 7; MIR-7; CD85j; LILRB1; ILT2; LIR1; MIR7
AA Sequence

GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH

Molecular Weight

100-120 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70182
Quantity:
MCE Japan Authorized Agent: