1. Recombinant Proteins
  2. Others
  3. Lipocalin-2/NGAL Protein, Human

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Lipocalin-2/NGAL Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

Background

Lipocalin-2/NGAL, an iron-trafficking protein, plays a pivotal role in diverse cellular processes, including apoptosis, innate immunity, and renal development. Through its interaction with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), bearing structural resemblance to bacterial enterobactin, Lipocalin-2/NGAL serves as a versatile mediator for the transport of iron into or out of cells, contingent on specific cellular requirements. The iron-bound form (holo-24p3) undergoes internalization upon binding to the SLC22A17 (24p3R) receptor, leading to the liberation of iron and a subsequent rise in intracellular iron concentration. Conversely, the association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor initiates a cascade involving an intracellular siderophore, resulting in iron chelation and subsequent extracellular iron transfer, ultimately reducing intracellular iron levels. In the context of apoptosis induced by interleukin-3 (IL3) deprivation, the iron-loaded form augments intracellular iron concentration without triggering apoptosis, while the iron-free form diminishes intracellular iron levels, inducing the expression of the proapoptotic protein BCL2L11/BIM, thereby promoting apoptosis. Lipocalin-2/NGAL's involvement in innate immunity manifests as it restricts bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin. Furthermore, Lipocalin-2/NGAL exhibits the ability to bind siderophores from M.tuberculosis. Its structural arrangements include a monomeric state and a homodimer linked by disulfide bonds, as well as a heterodimeric form in association with MMP9.

Biological Activity

Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3] in 30 min at 25°C. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in 2μM NGAL. >1.5 μM of Fe(DHBA)3 can be bound.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P80188-1 (Q21-G198)

Gene ID
Molecular Construction
N-term
NGAL (Q21-G198)
Accession # P80188-1
C-term
Synonyms
24p3; 25 kDa alpha 2 microglobulin related subunit of MMP9; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; Alpha 2 microglobulin related protein; HGNC:6526; HNL; Lcn 2; Lcn2; Lipocalin-2; Migration stimulating factor inhibitor; MSFI; Neutrophil gelatinase associated lipocalin; Neutrophil gelatinase associated lipocalin precursor; Neutrophil gelatinase-associated lipocalin; NGAL; NGAL_HUMAN; Oncogene 24p3; Oncogenic lipocalin 24p3; p25; Siderocalin; siderocalin LCN2; SV40 induced 24P3 protein; Uterocalin
AA Sequence

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Predicted Molecular Mass
20.5 kDa
Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer & Disulfide-linked homodimer
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of PBS with 0.05 % Tween-20, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lipocalin-2/NGAL Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lipocalin-2/NGAL Protein, Human
Cat. No.:
HY-P71934
Quantity:
MCE Japan Authorized Agent: