1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85a/ILT-5
  5. LILRB3/CD85a Protein, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293 , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293 , with C-6*His labeled tag. ,

Background

LILRB3/CD85a Protein appears to function as a receptor for class I MHC antigens, highlighting its integral role in immune recognition. Activation of LILRB3 is triggered upon coligation with immune receptors like FCGR2B and the B-cell receptor. This activation leads to the down-regulation of antigen-induced B-cell activation through the recruitment of phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). The protein further interacts with key signaling molecules including LYN, PTPN6/SHP-1, and PTPN11/SHP-2, emphasizing its involvement in intricate signaling cascades that regulate immune responses. A comprehensive exploration of LILRB3's interactions and its modulation of immune receptor activities could enhance our understanding of its function and potential implications in the fine-tuning of B-cell activation and immune regulation.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD85a is present at 2 μg/mL can bind Recombinant Human ANGPTL7. The ED50 for this effect is 730.8 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

AAC53219 (S25-Y640)

Gene ID

18733

Protein Length

Partial

Synonyms
Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; ILT-5; CD85a
AA Sequence

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Weight

Approximately 90 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB3/CD85a Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P77064A
Quantity:
MCE Japan Authorized Agent: