1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. LIR-9/CD85f LIR-9/CD85f
  5. LILRA5/CD85f Protein, Human (HEK293, His)

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (HEK293, His) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (HEK293, His) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-6*His labeled tag.

Background

LILRA5/CD85f Protein is suggested to potentially play a role in triggering innate immune responses, indicating its involvement in the early defense mechanisms against pathogens. However, it does not appear to have a role in recognizing any class I major histocompatibility complex (MHC) antigens. This distinctive feature suggests that LILRA5/CD85f may exert its immune-modulating effects through pathways independent of class I MHC antigen recognition, highlighting its unique role in the intricate landscape of innate immune responses. The specific molecular mechanisms underlying its participation in triggering innate immunity remain to be fully elucidated, warranting further exploration into its functional significance in the context of the immune system.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

A6NI73-1 (G42-R268)

Gene ID
Molecular Construction
N-term
LILRA5 (G42-R268)
Accession # A6NI73-1
6*His
C-term
Protein Length

Partial

Synonyms
Leukocyte immunoglobulin-like receptor subfamily A member 5; LILRA5; ILT-11; LIR-9; CD85f; LILRB7
AA Sequence

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Predicted Molecular Mass
26.1 kDa
Molecular Weight

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LILRA5/CD85f Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA5/CD85f Protein, Human (HEK293, His)
Cat. No.:
HY-P72521
Quantity:
MCE Japan Authorized Agent: