1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85e/LILRA3 CD85e/LILRA3
  5. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)

LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72393
Handling Instructions Technical Support

LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA3/CD85e/ILT6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA3/CD85e/ILT6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

LILRA3/CD85e/ILT6 acts as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, although with reduced affinities compared to LILRB1 or LILRB2. This protein exhibits a high-affinity interaction with the surface of monocytes, resulting in the suppression of LPS-induced TNF-alpha production by monocytes.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q8N6C8-1/AAH28208.1 (G24-E439)

Gene ID
Molecular Construction
N-term
LILRA3 (G24-E439)
Accession # Q8N6C8-1/AAH28208.1
6*His-Avi
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
CD85 antigen-like family member E; ILT-6; LIR-4 and Monocyte inhibitory receptor HM43/HM31
AA Sequence

GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Predicted Molecular Mass
47.9 kDa
Molecular Weight

Approximately 70-90 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72393
Quantity:
MCE Japan Authorized Agent: