1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Rat (HEK293, His)

Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Integrin alpha-2/beta-1, also known as ITGA2 protein, functions as a receptor for various extracellular matrix molecules including laminin, collagen, collagen C-propeptides, fibronectin, and E-cadherin. It specifically recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. This integrin plays a crucial role in mediating the adhesion of platelets and other cells to collagens. Additionally, it modulates the expression of collagen and collagenase genes, generates mechanical forces, and organizes newly synthesized extracellular matrix. In the context of microbial infection, the ITGA2:ITGB1 complex acts as a receptor for Human rotavirus A.

Biological Activity

Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×10^6 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×106 units/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P17777 (S23-F202)

Gene ID
Molecular Construction
N-term
LIF (S23-F202)
Accession # P17777
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
LIF; CDF; DIA; HILDA; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

Predicted Molecular Mass
19.8 kDa
Molecular Weight

Approximately 30-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIF Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Rat (HEK293, His)
Cat. No.:
HY-P78621
Quantity:
MCE Japan Authorized Agent: