1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Mouse

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Background

Leukemia Inhibitory Factor (LIF) has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2]. In the hematopoietic system, LIF induces the differentiation of certain leukemic cells and the proliferation of hematopoietic stem cells, megakaryocyte progenitor cells and DA1 cells. LIF also has activity in bone remodelling, induction of the acute phase response in hepatocytes, inhibition of adipogenesis, regulation of nerve differentiation and inhibition of kidney epithelial cell differentiation[3].

Biological Activity

1.The ED50 is <0.01 ng/mL as measured by M1 cells, corresponding to a specific activity of >1.0 × 108 units/mg.
2.Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells. The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
3.Measured in a cell proliferation assay using C2C12 cell. The ED50 for this effect is 0.3801-0.412 ng/mL.

  • Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells.The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P09056 (S24-F203)

Gene ID
Molecular Construction
N-term
LIF (S24-F203)
Accession # P09056
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuLIF; Differentiation-stimulating Factor; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPF

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, 150 mM NaCl, pH 8.0 or 20mM PB, 150mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCL, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Mouse
Cat. No.:
HY-P7084
Quantity:
MCE Japan Authorized Agent: